PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)

PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005592-D01P
PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKG1 protein.
Información adicional
Size 100 ug
Gene Name PRKG1
Gene Alias CGKI|DKFZp686K042|FLJ36117|MGC71944|PGK|PKG|PRKG1B|PRKGR1B|cGKI-BETA|cGKI-alpha
Gene Description protein kinase, cGMP-dependent, type I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKG1 (AAH62688.1, 1 a.a. ~ 312 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5592

Enviar uma mensagem


PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)

PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)