PRKCSH monoclonal antibody (M01), clone 3H7
  • PRKCSH monoclonal antibody (M01), clone 3H7

PRKCSH monoclonal antibody (M01), clone 3H7

Ref: AB-H00005589-M01
PRKCSH monoclonal antibody (M01), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKCSH.
Información adicional
Size 100 ug
Gene Name PRKCSH
Gene Alias AGE-R2|G19P1|PCLD|PLD1
Gene Description protein kinase C substrate 80K-H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq ISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVTSTTEPSRCEYLMELM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCSH (AAH13586, 268 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5589
Clone Number 3H7
Iso type IgG2a Kappa

Enviar uma mensagem


PRKCSH monoclonal antibody (M01), clone 3H7

PRKCSH monoclonal antibody (M01), clone 3H7