PRKCI monoclonal antibody (M04), clone 1C10
  • PRKCI monoclonal antibody (M04), clone 1C10

PRKCI monoclonal antibody (M04), clone 1C10

Ref: AB-H00005584-M04
PRKCI monoclonal antibody (M04), clone 1C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKCI.
Información adicional
Size 100 ug
Gene Name PRKCI
Gene Alias DXS1179E|MGC26534|PKCI|nPKC-iota
Gene Description protein kinase C, iota
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCI (AAH22016, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5584
Clone Number 1C10
Iso type IgG1 Kappa

Enviar uma mensagem


PRKCI monoclonal antibody (M04), clone 1C10

PRKCI monoclonal antibody (M04), clone 1C10