PRKCI monoclonal antibody (M02), clone 3A7
  • PRKCI monoclonal antibody (M02), clone 3A7

PRKCI monoclonal antibody (M02), clone 3A7

Ref: AB-H00005584-M02
PRKCI monoclonal antibody (M02), clone 3A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKCI.
Información adicional
Size 100 ug
Gene Name PRKCI
Gene Alias DXS1179E|MGC26534|PKCI|nPKC-iota
Gene Description protein kinase C, iota
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCI (AAH22016, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5584
Clone Number 3A7
Iso type IgG1 Kappa

Enviar uma mensagem


PRKCI monoclonal antibody (M02), clone 3A7

PRKCI monoclonal antibody (M02), clone 3A7