PRKCG polyclonal antibody (A01)
  • PRKCG polyclonal antibody (A01)

PRKCG polyclonal antibody (A01)

Ref: AB-H00005582-A01
PRKCG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKCG.
Información adicional
Size 50 uL
Gene Name PRKCG
Gene Alias MGC57564|PKC-gamma|PKCC|PKCG|SCA14
Gene Description protein kinase C, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCG (AAH47876, 260 a.a. ~ 351 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5582

Enviar uma mensagem


PRKCG polyclonal antibody (A01)

PRKCG polyclonal antibody (A01)