PRKCD monoclonal antibody (M02), clone 6A2
  • PRKCD monoclonal antibody (M02), clone 6A2

PRKCD monoclonal antibody (M02), clone 6A2

Ref: AB-H00005580-M02
PRKCD monoclonal antibody (M02), clone 6A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKCD.
Información adicional
Size 100 ug
Gene Name PRKCD
Gene Alias MAY1|MGC49908|PKCD|nPKC-delta
Gene Description protein kinase C, delta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5580
Clone Number 6A2
Iso type IgG2a Kappa

Enviar uma mensagem


PRKCD monoclonal antibody (M02), clone 6A2

PRKCD monoclonal antibody (M02), clone 6A2