PRKCA polyclonal antibody (A01)
  • PRKCA polyclonal antibody (A01)

PRKCA polyclonal antibody (A01)

Ref: AB-H00005578-A01
PRKCA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKCA.
Información adicional
Size 50 uL
Gene Name PRKCA
Gene Alias AAG6|MGC129900|MGC129901|PKC-alpha|PKCA|PRKACA
Gene Description protein kinase C, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCA (NP_002728, 563 a.a. ~ 672 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5578

Enviar uma mensagem


PRKCA polyclonal antibody (A01)

PRKCA polyclonal antibody (A01)