PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)

PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005571-D01P
PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKAG1 protein.
Información adicional
Size 100 ug
Gene Name PRKAG1
Gene Alias AMPKG|MGC8666
Gene Description protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKAG1 (NP_997626.1, 1 a.a. ~ 247 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5571

Enviar uma mensagem


PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)

PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)