PRKACG MaxPab mouse polyclonal antibody (B01P)
  • PRKACG MaxPab mouse polyclonal antibody (B01P)

PRKACG MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005568-B01P
PRKACG MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRKACG protein.
Información adicional
Size 50 ug
Gene Name PRKACG
Gene Alias KAPG|PKACg
Gene Description protein kinase, cAMP-dependent, catalytic, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKACG (NP_002723.2, 1 a.a. ~ 351 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5568

Enviar uma mensagem


PRKACG MaxPab mouse polyclonal antibody (B01P)

PRKACG MaxPab mouse polyclonal antibody (B01P)