PRKACB monoclonal antibody (M02), clone 1F8
  • PRKACB monoclonal antibody (M02), clone 1F8

PRKACB monoclonal antibody (M02), clone 1F8

Ref: AB-H00005567-M02
PRKACB monoclonal antibody (M02), clone 1F8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PRKACB.
Información adicional
Size 100 ug
Gene Name PRKACB
Gene Alias DKFZp781I2452|MGC41879|MGC9320|PKACB
Gene Description protein kinase, cAMP-dependent, catalytic, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKACB (AAH16285, 1 a.a. ~ 257 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5567
Clone Number 1F8
Iso type IgG2a Kappa

Enviar uma mensagem


PRKACB monoclonal antibody (M02), clone 1F8

PRKACB monoclonal antibody (M02), clone 1F8