PRKACA monoclonal antibody (M04A), clone X2
  • PRKACA monoclonal antibody (M04A), clone X2

PRKACA monoclonal antibody (M04A), clone X2

Ref: AB-H00005566-M04A
PRKACA monoclonal antibody (M04A), clone X2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKACA.
Información adicional
Size 200 uL
Gene Name PRKACA
Gene Alias MGC102831|MGC48865|PKACA
Gene Description protein kinase, cAMP-dependent, catalytic, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5566
Clone Number X2
Iso type IgG2a Kappa

Enviar uma mensagem


PRKACA monoclonal antibody (M04A), clone X2

PRKACA monoclonal antibody (M04A), clone X2