PRKAB2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRKAB2 purified MaxPab rabbit polyclonal antibody (D01P)

PRKAB2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005565-D01P
PRKAB2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKAB2 protein.
Información adicional
Size 100 ug
Gene Name PRKAB2
Gene Alias MGC61468
Gene Description protein kinase, AMP-activated, beta 2 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKAB2 (NP_005390.1, 1 a.a. ~ 272 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5565

Enviar uma mensagem


PRKAB2 purified MaxPab rabbit polyclonal antibody (D01P)

PRKAB2 purified MaxPab rabbit polyclonal antibody (D01P)