PRKAB1 monoclonal antibody (M02), clone 2C3
  • PRKAB1 monoclonal antibody (M02), clone 2C3

PRKAB1 monoclonal antibody (M02), clone 2C3

Ref: AB-H00005564-M02
PRKAB1 monoclonal antibody (M02), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PRKAB1.
Información adicional
Size 100 ug
Gene Name PRKAB1
Gene Alias AMPK|HAMPKb|MGC17785
Gene Description protein kinase, AMP-activated, beta 1 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKAB1 (AAH01007, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5564
Clone Number 2C3
Iso type IgG2a Kappa

Enviar uma mensagem


PRKAB1 monoclonal antibody (M02), clone 2C3

PRKAB1 monoclonal antibody (M02), clone 2C3