PRG2 purified MaxPab mouse polyclonal antibody (B01P)
  • PRG2 purified MaxPab mouse polyclonal antibody (B01P)

PRG2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005553-B01P
PRG2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRG2 protein.
Información adicional
Size 50 ug
Gene Name PRG2
Gene Alias BMPG|MBP|MBP1|MGC14537
Gene Description proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTQPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRG2 (AAH05929.1, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5553

Enviar uma mensagem


PRG2 purified MaxPab mouse polyclonal antibody (B01P)

PRG2 purified MaxPab mouse polyclonal antibody (B01P)