PRF1 monoclonal antibody (M04), clone 3B4
  • PRF1 monoclonal antibody (M04), clone 3B4

PRF1 monoclonal antibody (M04), clone 3B4

Ref: AB-H00005551-M04
PRF1 monoclonal antibody (M04), clone 3B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRF1.
Información adicional
Size 100 ug
Gene Name PRF1
Gene Alias FLH2|HPLH2|MGC65093|P1|PFN1|PFP
Gene Description perforin 1 (pore forming protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRF1 (NP_005032.2, 461 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5551
Clone Number 3B4
Iso type IgG2a Kappa

Enviar uma mensagem


PRF1 monoclonal antibody (M04), clone 3B4

PRF1 monoclonal antibody (M04), clone 3B4