PREP monoclonal antibody (M04), clone 2D7
  • PREP monoclonal antibody (M04), clone 2D7

PREP monoclonal antibody (M04), clone 2D7

Ref: AB-H00005550-M04
PREP monoclonal antibody (M04), clone 2D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PREP.
Información adicional
Size 100 ug
Gene Name PREP
Gene Alias MGC16060|PE|PEP
Gene Description prolyl endopeptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PREP (NP_002717.3, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5550
Clone Number 2D7
Iso type IgG2b Kappa

Enviar uma mensagem


PREP monoclonal antibody (M04), clone 2D7

PREP monoclonal antibody (M04), clone 2D7