PREP purified MaxPab mouse polyclonal antibody (B01P)
  • PREP purified MaxPab mouse polyclonal antibody (B01P)

PREP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005550-B01P
PREP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PREP protein.
Información adicional
Size 50 ug
Gene Name PREP
Gene Alias MGC16060|PE|PEP
Gene Description prolyl endopeptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PREP (NP_002717.3, 1 a.a. ~ 710 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5550

Enviar uma mensagem


PREP purified MaxPab mouse polyclonal antibody (B01P)

PREP purified MaxPab mouse polyclonal antibody (B01P)