PRELP monoclonal antibody (M01A), clone 3H1
  • PRELP monoclonal antibody (M01A), clone 3H1

PRELP monoclonal antibody (M01A), clone 3H1

Ref: AB-H00005549-M01A
PRELP monoclonal antibody (M01A), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRELP.
Información adicional
Size 200 uL
Gene Name PRELP
Gene Alias MGC45323|MST161|MSTP161|SLRR2A
Gene Description proline/arginine-rich end leucine-rich repeat protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRELP (NP_002716.1, 281 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5549
Clone Number 3H1
Iso type IgM Kappa

Enviar uma mensagem


PRELP monoclonal antibody (M01A), clone 3H1

PRELP monoclonal antibody (M01A), clone 3H1