PPP6C purified MaxPab mouse polyclonal antibody (B01P)
  • PPP6C purified MaxPab mouse polyclonal antibody (B01P)

PPP6C purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005537-B01P
PPP6C purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP6C protein.
Información adicional
Size 50 ug
Gene Name PPP6C
Gene Alias FLJ92648|MGC12249
Gene Description protein phosphatase 6, catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP6C (AAH06990, 1 a.a. ~ 305 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5537

Enviar uma mensagem


PPP6C purified MaxPab mouse polyclonal antibody (B01P)

PPP6C purified MaxPab mouse polyclonal antibody (B01P)