PPP5C MaxPab rabbit polyclonal antibody (D01)
  • PPP5C MaxPab rabbit polyclonal antibody (D01)

PPP5C MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005536-D01
PPP5C MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPP5C protein.
Información adicional
Size 100 uL
Gene Name PPP5C
Gene Alias FLJ36922|PP5|PPP5
Gene Description protein phosphatase 5, catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP5C (NP_006238.1, 1 a.a. ~ 499 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5536

Enviar uma mensagem


PPP5C MaxPab rabbit polyclonal antibody (D01)

PPP5C MaxPab rabbit polyclonal antibody (D01)