PPP3R2 purified MaxPab mouse polyclonal antibody (B01P)
  • PPP3R2 purified MaxPab mouse polyclonal antibody (B01P)

PPP3R2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005535-B01P
PPP3R2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP3R2 protein.
Información adicional
Size 50 ug
Gene Name PPP3R2
Gene Alias PPP3RL
Gene Description protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP3R2 (NP_671709.1, 1 a.a. ~ 173 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5535

Enviar uma mensagem


PPP3R2 purified MaxPab mouse polyclonal antibody (B01P)

PPP3R2 purified MaxPab mouse polyclonal antibody (B01P)