PPP3R1 monoclonal antibody (M01), clone 4E1
  • PPP3R1 monoclonal antibody (M01), clone 4E1

PPP3R1 monoclonal antibody (M01), clone 4E1

Ref: AB-H00005534-M01
PPP3R1 monoclonal antibody (M01), clone 4E1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PPP3R1.
Información adicional
Size 100 ug
Gene Name PPP3R1
Gene Alias CALNB1|CNB|CNB1
Gene Description protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP3R1 (AAH27913, 1 a.a. ~ 170 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5534
Clone Number 4E1
Iso type IgG1 Kappa

Enviar uma mensagem


PPP3R1 monoclonal antibody (M01), clone 4E1

PPP3R1 monoclonal antibody (M01), clone 4E1