PPP2R5D monoclonal antibody (M21), clone 1A3
  • PPP2R5D monoclonal antibody (M21), clone 1A3

PPP2R5D monoclonal antibody (M21), clone 1A3

Ref: AB-H00005528-M21
PPP2R5D monoclonal antibody (M21), clone 1A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP2R5D.
Información adicional
Size 100 ug
Gene Name PPP2R5D
Gene Alias B56D|MGC2134|MGC8949
Gene Description protein phosphatase 2, regulatory subunit B', delta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP2R5D (NP_006236.1, 514 a.a. ~ 602 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5528
Clone Number 1A3
Iso type IgG1 Kappa

Enviar uma mensagem


PPP2R5D monoclonal antibody (M21), clone 1A3

PPP2R5D monoclonal antibody (M21), clone 1A3