PPP2R4 polyclonal antibody (A01)
  • PPP2R4 polyclonal antibody (A01)

PPP2R4 polyclonal antibody (A01)

Ref: AB-H00005524-A01
PPP2R4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPP2R4.
Información adicional
Size 50 uL
Gene Name PPP2R4
Gene Alias MGC2184|PP2A|PR53|PTPA
Gene Description protein phosphatase 2A activator, regulatory subunit 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP2R4 (NP_066954, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5524

Enviar uma mensagem


PPP2R4 polyclonal antibody (A01)

PPP2R4 polyclonal antibody (A01)