PPP2R1B MaxPab rabbit polyclonal antibody (D01)
  • PPP2R1B MaxPab rabbit polyclonal antibody (D01)

PPP2R1B MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005519-D01
PPP2R1B MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPP2R1B protein.
Información adicional
Size 100 uL
Gene Name PPP2R1B
Gene Alias MGC26454|PR65B
Gene Description protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP2R1B (NP_002707.3, 1 a.a. ~ 601 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5519

Enviar uma mensagem


PPP2R1B MaxPab rabbit polyclonal antibody (D01)

PPP2R1B MaxPab rabbit polyclonal antibody (D01)