View larger
Mouse monoclonal antibody raised against a full-length recombinant PPP2R1A.
AB-H00005518-M02
New product
PPP2R1A monoclonal antibody (M02), clone 4E6
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PPP2R1A |
| Gene Alias | MGC786|PR65A |
| Gene Description | protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,S-ELISA,ELISA,PLA-Ce |
| Immunogen Prot. Seq | MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFATLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PPP2R1A (AAH01537, 1 a.a. ~ 589 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5518 |
| Clone Number | 4E6 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a full-length recombinant PPP2R1A.