PPP1R10 monoclonal antibody (M02), clone 1D6
  • PPP1R10 monoclonal antibody (M02), clone 1D6

PPP1R10 monoclonal antibody (M02), clone 1D6

Ref: AB-H00005514-M02
PPP1R10 monoclonal antibody (M02), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP1R10.
Información adicional
Size 100 ug
Gene Name PPP1R10
Gene Alias CAT53|FB19|PNUTS|PP1R10
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1R10 (NP_002705.2, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5514
Clone Number 1D6
Iso type IgG2a Kappa

Enviar uma mensagem


PPP1R10 monoclonal antibody (M02), clone 1D6

PPP1R10 monoclonal antibody (M02), clone 1D6