PPP1R3C purified MaxPab rabbit polyclonal antibody (D01P)
  • PPP1R3C purified MaxPab rabbit polyclonal antibody (D01P)

PPP1R3C purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005507-D01P
PPP1R3C purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPP1R3C protein.
Información adicional
Size 100 ug
Gene Name PPP1R3C
Gene Alias PPP1R5
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 3C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKVQIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPVIPTEQKIEFCISYHANGQVFWDNNDGQNYR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP1R3C (NP_005389.1, 1 a.a. ~ 317 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5507

Enviar uma mensagem


PPP1R3C purified MaxPab rabbit polyclonal antibody (D01P)

PPP1R3C purified MaxPab rabbit polyclonal antibody (D01P)