PPP1R2 monoclonal antibody (M01), clone 2E9
  • PPP1R2 monoclonal antibody (M01), clone 2E9

PPP1R2 monoclonal antibody (M01), clone 2E9

Ref: AB-H00005504-M01
PPP1R2 monoclonal antibody (M01), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP1R2.
Información adicional
Size 100 ug
Gene Name PPP1R2
Gene Alias IPP2|MGC87148
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1R2 (NP_006232, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5504
Clone Number 2E9
Iso type IgG2a Kappa

Enviar uma mensagem


PPP1R2 monoclonal antibody (M01), clone 2E9

PPP1R2 monoclonal antibody (M01), clone 2E9