PPP1CC purified MaxPab mouse polyclonal antibody (B02P)
  • PPP1CC purified MaxPab mouse polyclonal antibody (B02P)

PPP1CC purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00005501-B02P
PPP1CC purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP1CC protein.
Información adicional
Size 50 ug
Gene Name PPP1CC
Gene Alias PPP1G
Gene Description protein phosphatase 1, catalytic subunit, gamma isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP1CC (NP_002701.1, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5501

Enviar uma mensagem


PPP1CC purified MaxPab mouse polyclonal antibody (B02P)

PPP1CC purified MaxPab mouse polyclonal antibody (B02P)