PPP1CC polyclonal antibody (A01)
  • PPP1CC polyclonal antibody (A01)

PPP1CC polyclonal antibody (A01)

Ref: AB-H00005501-A01
PPP1CC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PPP1CC.
Información adicional
Size 50 uL
Gene Name PPP1CC
Gene Alias PPP1G
Gene Description protein phosphatase 1, catalytic subunit, gamma isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1CC (AAH14073, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5501

Enviar uma mensagem


PPP1CC polyclonal antibody (A01)

PPP1CC polyclonal antibody (A01)