PPP1CB monoclonal antibody (M02), clone 8A7
  • PPP1CB monoclonal antibody (M02), clone 8A7

PPP1CB monoclonal antibody (M02), clone 8A7

Ref: AB-H00005500-M02
PPP1CB monoclonal antibody (M02), clone 8A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP1CB.
Información adicional
Size 100 ug
Gene Name PPP1CB
Gene Alias MGC3672|PP-1B|PPP1CD
Gene Description protein phosphatase 1, catalytic subunit, beta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1CB (NP_002700, 231 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5500
Clone Number 8A7
Iso type IgG2a Kappa

Enviar uma mensagem


PPP1CB monoclonal antibody (M02), clone 8A7

PPP1CB monoclonal antibody (M02), clone 8A7