PPP1CB polyclonal antibody (A01)
  • PPP1CB polyclonal antibody (A01)

PPP1CB polyclonal antibody (A01)

Ref: AB-H00005500-A01
PPP1CB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPP1CB.
Información adicional
Size 50 uL
Gene Name PPP1CB
Gene Alias MGC3672|PP-1B|PPP1CD
Gene Description protein phosphatase 1, catalytic subunit, beta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1CB (NP_002700, 231 a.a. ~ 327 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5500

Enviar uma mensagem


PPP1CB polyclonal antibody (A01)

PPP1CB polyclonal antibody (A01)