PPP1CA polyclonal antibody (A01)
  • PPP1CA polyclonal antibody (A01)

PPP1CA polyclonal antibody (A01)

Ref: AB-H00005499-A01
PPP1CA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPP1CA.
Información adicional
Size 50 uL
Gene Name PPP1CA
Gene Alias MGC15877|MGC1674|PP-1A|PPP1A
Gene Description protein phosphatase 1, catalytic subunit, alpha isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1CA (NP_002699, 224 a.a. ~ 330 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5499

Enviar uma mensagem


PPP1CA polyclonal antibody (A01)

PPP1CA polyclonal antibody (A01)