PPOX monoclonal antibody (M04A), clone 2B5
  • PPOX monoclonal antibody (M04A), clone 2B5

PPOX monoclonal antibody (M04A), clone 2B5

Ref: AB-H00005498-M04A
PPOX monoclonal antibody (M04A), clone 2B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPOX.
Información adicional
Size 200 uL
Gene Name PPOX
Gene Alias MGC8485|PPO|V290M|VP
Gene Description protoporphyrinogen oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5498
Clone Number 2B5
Iso type IgG2a Kappa

Enviar uma mensagem


PPOX monoclonal antibody (M04A), clone 2B5

PPOX monoclonal antibody (M04A), clone 2B5