PPIC monoclonal antibody (M03), clone 1A10
  • PPIC monoclonal antibody (M03), clone 1A10

PPIC monoclonal antibody (M03), clone 1A10

Ref: AB-H00005480-M03
PPIC monoclonal antibody (M03), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PPIC.
Información adicional
Size 100 ug
Gene Name PPIC
Gene Alias CYPC|MGC3673
Gene Description peptidylprolyl isomerase C (cyclophilin C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIC (AAH02678.1, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5480
Clone Number 1A10
Iso type IgG2a Kappa

Enviar uma mensagem


PPIC monoclonal antibody (M03), clone 1A10

PPIC monoclonal antibody (M03), clone 1A10