PPIA polyclonal antibody (A01)
  • PPIA polyclonal antibody (A01)

PPIA polyclonal antibody (A01)

Ref: AB-H00005478-A01
PPIA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PPIA.
Información adicional
Size 50 uL
Gene Name PPIA
Gene Alias CYPA|CYPH|MGC117158|MGC12404|MGC23397
Gene Description peptidylprolyl isomerase A (cyclophilin A)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIA (AAH00689.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5478

Enviar uma mensagem


PPIA polyclonal antibody (A01)

PPIA polyclonal antibody (A01)