PPARG polyclonal antibody (A01)
  • PPARG polyclonal antibody (A01)

PPARG polyclonal antibody (A01)

Ref: AB-H00005468-A01
PPARG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPARG.
Información adicional
Size 50 uL
Gene Name PPARG
Gene Alias CIMT1|NR1C3|PPARG1|PPARG2|PPARgamma
Gene Description peroxisome proliferator-activated receptor gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPARG (NP_619726, 366 a.a. ~ 475 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5468

Enviar uma mensagem


PPARG polyclonal antibody (A01)

PPARG polyclonal antibody (A01)