PPARA monoclonal antibody (M03), clone 1A8
  • PPARA monoclonal antibody (M03), clone 1A8

PPARA monoclonal antibody (M03), clone 1A8

Ref: AB-H00005465-M03
PPARA monoclonal antibody (M03), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PPARA.
Información adicional
Size 100 ug
Gene Name PPARA
Gene Alias MGC2237|MGC2452|NR1C1|PPAR|hPPAR
Gene Description peroxisome proliferator-activated receptor alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGRSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPARA (AAH00052, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5465
Clone Number 1A8
Iso type IgG2a Kappa

Enviar uma mensagem


PPARA monoclonal antibody (M03), clone 1A8

PPARA monoclonal antibody (M03), clone 1A8