PPARA purified MaxPab mouse polyclonal antibody (B01P)
  • PPARA purified MaxPab mouse polyclonal antibody (B01P)

PPARA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005465-B01P
PPARA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPARA protein.
Información adicional
Size 50 ug
Gene Name PPARA
Gene Alias MGC2237|MGC2452|NR1C1|PPAR|hPPAR
Gene Description peroxisome proliferator-activated receptor alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPARA (NP_001001928.1, 1 a.a. ~ 468 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5465

Enviar uma mensagem


PPARA purified MaxPab mouse polyclonal antibody (B01P)

PPARA purified MaxPab mouse polyclonal antibody (B01P)