PP polyclonal antibody (A01)
  • PP polyclonal antibody (A01)

PP polyclonal antibody (A01)

Ref: AB-H00005464-A01
PP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PP.
Información adicional
Size 50 uL
Gene Name PPA1
Gene Alias IOPPP|MGC111556|PP|PP1|SID6-8061
Gene Description pyrophosphatase (inorganic) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PP (NP_066952, 10 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5464

Enviar uma mensagem


PP polyclonal antibody (A01)

PP polyclonal antibody (A01)