POU6F1 monoclonal antibody (M03), clone 6F10
  • POU6F1 monoclonal antibody (M03), clone 6F10

POU6F1 monoclonal antibody (M03), clone 6F10

Ref: AB-H00005463-M03
POU6F1 monoclonal antibody (M03), clone 6F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POU6F1.
Información adicional
Size 100 ug
Gene Name POU6F1
Gene Alias BRN5|MPOU|TCFB1
Gene Description POU class 6 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU6F1 (NP_002693, 193 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5463
Clone Number 6F10
Iso type IgG2a Kappa

Enviar uma mensagem


POU6F1 monoclonal antibody (M03), clone 6F10

POU6F1 monoclonal antibody (M03), clone 6F10