POU4F3 polyclonal antibody (A01)
  • POU4F3 polyclonal antibody (A01)

POU4F3 polyclonal antibody (A01)

Ref: AB-H00005459-A01
POU4F3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POU4F3.
Información adicional
Size 50 uL
Gene Name POU4F3
Gene Alias BRN3C|DFNA15|MGC138412
Gene Description POU class 4 homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5459

Enviar uma mensagem


POU4F3 polyclonal antibody (A01)

POU4F3 polyclonal antibody (A01)