POU3F3 polyclonal antibody (A01)
  • POU3F3 polyclonal antibody (A01)

POU3F3 polyclonal antibody (A01)

Ref: AB-H00005455-A01
POU3F3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POU3F3.
Información adicional
Size 50 uL
Gene Name POU3F3
Gene Alias BRN1|OTF8
Gene Description POU class 3 homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTSVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU3F3 (NP_006227, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5455

Enviar uma mensagem


POU3F3 polyclonal antibody (A01)

POU3F3 polyclonal antibody (A01)