POU3F2 monoclonal antibody (M01), clone 6F6
  • POU3F2 monoclonal antibody (M01), clone 6F6

POU3F2 monoclonal antibody (M01), clone 6F6

Ref: AB-H00005454-M01
POU3F2 monoclonal antibody (M01), clone 6F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POU3F2.
Información adicional
Size 100 ug
Gene Name POU3F2
Gene Alias BRN2|OCT7|OTF7|POUF3
Gene Description POU class 3 homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU3F2 (NP_005595, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5454
Clone Number 6F6
Iso type IgG2b Kappa

Enviar uma mensagem


POU3F2 monoclonal antibody (M01), clone 6F6

POU3F2 monoclonal antibody (M01), clone 6F6