POU3F2 polyclonal antibody (A01)
  • POU3F2 polyclonal antibody (A01)

POU3F2 polyclonal antibody (A01)

Ref: AB-H00005454-A01
POU3F2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POU3F2.
Información adicional
Size 50 uL
Gene Name POU3F2
Gene Alias BRN2|OCT7|OTF7|POUF3
Gene Description POU class 3 homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU3F2 (NP_005595, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5454

Enviar uma mensagem


POU3F2 polyclonal antibody (A01)

POU3F2 polyclonal antibody (A01)