POU2AF1 polyclonal antibody (A01)
  • POU2AF1 polyclonal antibody (A01)

POU2AF1 polyclonal antibody (A01)

Ref: AB-H00005450-A01
POU2AF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POU2AF1.
Información adicional
Size 50 uL
Gene Name POU2AF1
Gene Alias BOB1|OBF-1|OBF1|OCAB
Gene Description POU class 2 associating factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYRPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU2AF1 (NP_006226, 159 a.a. ~ 255 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5450

Enviar uma mensagem


POU2AF1 polyclonal antibody (A01)

POU2AF1 polyclonal antibody (A01)