PON3 purified MaxPab rabbit polyclonal antibody (D01P)
  • PON3 purified MaxPab rabbit polyclonal antibody (D01P)

PON3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005446-D01P
PON3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PON3 protein.
Información adicional
Size 100 ug
Gene Name PON3
Gene Alias -
Gene Description paraoxonase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGKLVALVLLGVGLSLVGEMFLAFRERVNASREVEPVEPENCHLIEELENGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVADVAAKNIHIMEKHDNWDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PON3 (AAH70374.1, 1 a.a. ~ 354 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5446

Enviar uma mensagem


PON3 purified MaxPab rabbit polyclonal antibody (D01P)

PON3 purified MaxPab rabbit polyclonal antibody (D01P)