PON1 polyclonal antibody (A01)
  • PON1 polyclonal antibody (A01)

PON1 polyclonal antibody (A01)

Ref: AB-H00005444-A01
PON1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PON1.
Información adicional
Size 50 uL
Gene Name PON1
Gene Alias ESA|PON
Gene Description paraoxonase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PON1 (NP_000437, 246 a.a. ~ 355 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5444

Enviar uma mensagem


PON1 polyclonal antibody (A01)

PON1 polyclonal antibody (A01)