POLR2H polyclonal antibody (A01)
  • POLR2H polyclonal antibody (A01)

POLR2H polyclonal antibody (A01)

Ref: AB-H00005437-A01
POLR2H polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant POLR2H.
Información adicional
Size 50 uL
Gene Name POLR2H
Gene Alias RPABC3|RPB17|RPB8|hsRPB8
Gene Description polymerase (RNA) II (DNA directed) polypeptide H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLR2H (AAH00739, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5437

Enviar uma mensagem


POLR2H polyclonal antibody (A01)

POLR2H polyclonal antibody (A01)